PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0023400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 278aa    MW: 30772 Da    PI: 8.928
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0023400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv ++k+ G+g+W++++++ g+ R+ k+c++rw +yl
   Spipo4G0023400 14 KGPWTPEEDIVLVTYIKENGPGNWRAVPSKTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.89.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Spipo4G0023400  67 RGNFTEQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.558961IPR017930Myb domain
SuperFamilySSF466891.57E-2911108IPR009057Homeodomain-like
SMARTSM007172.8E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001674.21E-101661No hitNo description
PROSITE profilePS5129424.85962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2465116IPR009057Homeodomain-like
SMARTSM007171.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001679.60E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVRPPCCDKT GVKKGPWTPE EDIVLVTYIK ENGPGNWRAV PSKTGLLRCS KSCRLRWTNY  60
LRPGVKRGNF TEQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLRKGQ  120
SGAGDVSWSL PMAKGQWERR LQTDIHMAKR ALSEALSLEI PCPALELKRP SSYDHAVAKQ  180
PATLSTATYA SSADNISRLL QGWMTNTPKQ SYSESTEHSN STAGGGVDSA SSIVGVQNNT  240
IESLISPEAS LIPEEQKPVP LSFLENWLFN EGLAELL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-26141164105C-Myb DNA-Binding Domain
1msf_C6e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258354.11e-116PREDICTED: myb-related protein 306
SwissprotP813921e-100MYB06_ANTMA; Myb-related protein 306
TrEMBLF6GT801e-114F6GT80_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g06190.t011e-113(Vitis vinifera)
STRINGGLYMA18G49360.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.13e-94myb domain protein 94